PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G108500.1
Common NamePHAVU_007G108500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 268aa    MW: 30537.1 Da    PI: 5.4396
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G108500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W +eEd++l  +++++G g+W++ ++  g+ R++k+c++rw +yl
  Phvul.007G108500.1 14 KGPWAPEEDQILTSYIQKHGHGNWRALPKQAGLLRCGKSCRLRWINYL 61
                        79******************************99************97 PP

2Myb_DNA-binding53.17.1e-1767111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg++T eE+e+++++++ lG++ W++Ia++++ gRt++++k+ w++ 
  Phvul.007G108500.1  67 RGNFTSEEEEIILKLHETLGNR-WSAIAAKLP-GRTDNEIKNVWHTN 111
                         89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.976961IPR017930Myb domain
SuperFamilySSF466897.49E-3110108IPR009057Homeodomain-like
SMARTSM007176.2E-131363IPR001005SANT/Myb domain
PfamPF002496.0E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-251568IPR009057Homeodomain-like
CDDcd001675.51E-101661No hitNo description
PROSITE profilePS5129424.44762116IPR017930Myb domain
SMARTSM007178.2E-1566114IPR001005SANT/Myb domain
PfamPF002495.3E-1567111IPR001005SANT/Myb domain
CDDcd001676.79E-1169112No hitNo description
Gene3DG3DSA:1.10.10.607.3E-2669116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWAPE EDQILTSYIQ KHGHGNWRAL PKQAGLLRCG KSCRLRWINY  60
LKPDIKRGNF TSEEEEIILK LHETLGNRWS AIAAKLPGRT DNEIKNVWHT NLKKRLLKAD  120
QSSSNSRRVT KPKIKRSDSN SSIVTQSEQT NFNFREMDST SACTTSSDFS SVTVGDSKNI  180
KCEDIDSLET MPVIDESFWS EPAIDETPSM SSQSMTFADQ MPLQYPFTNY EETFQPSHAY  240
DSNFDDGMDF WYDIFTRTAD STELPDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0291650.0AB029165.1 Glycine max GmMYB29B2 gene, complete cds.
GenBankBT0971170.0BT097117.1 Soybean clone JCVI-FLGm-21J11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143866.10.0hypothetical protein PHAVU_007G108500g
TrEMBLV7BE540.0V7BE54_PHAVU; Uncharacterized protein
STRINGGLYMA20G35180.11e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-87myb domain protein 15